DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hts and mug14

DIOPT Version :9

Sequence 1:NP_001097377.2 Gene:hts / 37230 FlyBaseID:FBgn0263391 Length:1833 Species:Drosophila melanogaster
Sequence 2:NP_595056.1 Gene:mug14 / 2540926 PomBaseID:SPBC359.06 Length:257 Species:Schizosaccharomyces pombe


Alignment Length:219 Identity:59/219 - (26%)
Similarity:99/219 - (45%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LAATFRLLDLYGWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTN 187
            :||.||:....|:.:|....:|.|..:|:..|.:||..:.:..:..|.|..::..|:|:  |.:.
pombe    24 MAAAFRMFGRNGYNEGTAGHVTVRDPIDENTFWINPLEVPFSLMKPSDLVHINSDGEII--GGSK 86

  Fly   188 FGGNKSHFVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVLGEITTHA-YTGLF 251
            ...|.|.|.:|..:|..||::.|..::......|.|:|...|..|..|.||.  ...|. |..:.
pombe    87 MKYNTSGFAIHYEMHKVRPEVICVCHVHSIYGKAFSALGKPLDMLNTDCCVF--YNNHGIYFDMD 149

  Fly   252 D----EEERNRLVRSLGPNSKVILLTNHGALCCGETIEEAFFAACHIVQACETQLKLLPVGLDNL 312
            |    .||..|..:.|. :.|.:|:.|||.:..|.|::||.:....:.::|:.||.     :|:.
pombe   150 DVISMPEEGRRTAKGLA-DYKAVLVQNHGIMTVGTTVDEAAYLLSLMERSCQIQLL-----IDSA 208

  Fly   313 VLIPEESR------KAIYEQSRRP 330
            ..:.|...      |||.|.:..|
pombe   209 TKVGERKHVHPTRAKAIRENADNP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htsNP_001097377.2 Aldolase_II 116..323 CDD:238232 55/210 (26%)
mug14NP_595056.1 Aldolase_II 8..246 CDD:294146 59/219 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001205
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100477
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.