DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cer and RD21A

DIOPT Version :9

Sequence 1:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_564497.1	Gene:	RD21A / 841122	AraportID:	AT1G47128	Length:	462	Species:	Arabidopsis thaliana

Alignment Length:	66	Identity:	18/66 - (27%)
Similarity:	36/66 - (54%)	Gaps:	6/66 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 EEW-VEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |.| |::.....:|...|:| .|..|:.::...::|||.|    .:::::|:...||||.:|:..
plant    51 EAWLVKHGKAQSQNSLVEKD-RRFEIFKDNLRFVDEHNEK----NLSYRLGLTRFADLTNDEYRS 110

  Fly    71 R 71
            :
plant   111 K 111

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	16/59 (27%)
RD21A	NP_564497.1	Inhibitor_I29	50..107	CDD:214853	17/60 (28%)
		Peptidase_C1	137..352	CDD:395062
		GRAN	376..432	CDD:197621
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4870
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900