DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and CP1

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_195406.2 Gene:CP1 / 829841 AraportID:AT4G36880 Length:376 Species:Arabidopsis thaliana


Alignment Length:83 Identity:17/83 - (20%)
Similarity:35/83 - (42%) Gaps:17/83 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVSDEEW----------VEYKSKFDKNYEAEEDLM-----RRRIYAESKARIEEHNRKFEKGE 50
            :.|.||.:|          :::.::..|.......::     |..|:.::...|:.||.  ....
plant    31 LQLPSDGKWRTDEEVRSIYLQWSAEHGKTNNNNNGIINDQDKRFNIFKDNLRFIDLHNE--NNKN 93

  Fly    51 VTWKMGINHLADLTPEEF 68
            .|:|:|:....|||.:|:
plant    94 ATYKLGLTKFTDLTNDEY 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 13/73 (18%)
CP1NP_195406.2 Inhibitor_I29 49..110 CDD:214853 12/62 (19%)
Peptidase_C1 145..361 CDD:395062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.