powered by:
Protein Alignment cer and AT3G19400
DIOPT Version :9
Sequence 1: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_566634.2 |
Gene: | AT3G19400 / 821474 |
AraportID: | AT3G19400 |
Length: | 362 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 22/64 - (34%) |
Similarity: | 37/64 - (57%) |
Gaps: | 9/64 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 EEW-VEYKSKFDKNYEAEEDLMRR-RIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
|:| ||.: |||....:..|| :|:.::...::|||...:: |:::|:...||||.|||
plant 45 EQWLVENR----KNYNGLGEKERRFKIFKDNLKFVDEHNSVPDR---TFEVGLTRFADLTNEEF 101
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.