DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cer and AT3G19400

DIOPT Version :9

Sequence 1:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_566634.2	Gene:	AT3G19400 / 821474	AraportID:	AT3G19400	Length:	362	Species:	Arabidopsis thaliana

Alignment Length:	64	Identity:	22/64 - (34%)
Similarity:	37/64 - (57%)	Gaps:	9/64 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 EEW-VEYKSKFDKNYEAEEDLMRR-RIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
            |:| ||.:    |||....:..|| :|:.::...::|||...::   |:::|:...||||.|||
plant    45 EQWLVENR----KNYNGLGEKERRFKIFKDNLKFVDEHNSVPDR---TFEVGLTRFADLTNEEF 101

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	19/60 (32%)
AT3G19400	NP_566634.2	Inhibitor_I29	44..100	CDD:214853	19/61 (31%)
AT3G19400	NP_566634.2	Peptidase_C1	130..348	CDD:395062
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4870
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900