DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cer and Cts8

DIOPT Version :9

Sequence 1:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_001121688.1	Gene:	Cts8 / 680718	RGDID:	1588248	Length:	333	Species:	Rattus norvegicus

Alignment Length:	63	Identity:	23/63 - (36%)
Similarity:	43/63 - (68%)	Gaps:	0/63 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
            |.||.|:|:|::|||..||:..:|.::.|:...:::||.::::.:..:.|.:|..||:|.|||
  Rat    26 DSEWQEWKTKYEKNYSLEEEGQKRAVWEENMKVVKQHNIEYDQEKKNFTMELNAFADMTGEEF 88

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	19/58 (33%)
Cts8	NP_001121688.1	PTZ00203	5..327	CDD:185513	23/63 (37%)
		Inhibitor_I29	29..87	CDD:214853	18/57 (32%)
		Peptidase_C1A	115..331	CDD:239068
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	61	1.000	Domainoid score	I10169
eggNOG	1	0.900	-	-		E1_COG4870
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810