DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and Ctsb

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_072119.2 Gene:Ctsb / 64529 RGDID:621509 Length:339 Species:Rattus norvegicus


Alignment Length:35 Identity:8/35 - (22%)
Similarity:15/35 - (42%) Gaps:8/35 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRCG 73
            |.:.|..::.|...:.:.|::|..|        ||
  Rat    34 INKQNTTWQAGRNFYNVDISYLKKL--------CG 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 6/28 (21%)
CtsbNP_072119.2 Peptidase_C1A_CathepsinB 81..328 CDD:239111
Propeptide_C1 26..65 CDD:462365 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.