powered by:
Protein Alignment cer and Tpbpa
DIOPT Version :9
Sequence 1: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_742070.1 |
Gene: | Tpbpa / 64509 |
RGDID: | 621454 |
Length: | 124 |
Species: | Rattus norvegicus |
Alignment Length: | 41 |
Identity: | 10/41 - (24%) |
Similarity: | 24/41 - (58%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 RRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
|:.::.|....::.:|.|.::.|....:.::.|::||.|:|
Rat 39 RKAVWDEFMKTVKLYNSKSDQEEEELDIEMSALSELTDEDF 79
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
cer | NP_611420.1 |
Inhibitor_I29 |
9..68 |
CDD:400519 |
9/39 (23%) |
Tpbpa | NP_742070.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.