DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and LOC594890

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001076821.2 Gene:LOC594890 / 594890 -ID:- Length:333 Species:Xenopus tropicalis


Alignment Length:69 Identity:25/69 - (36%)
Similarity:38/69 - (55%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRCG 73
            ||:...|..|| |.|| |.||.|:.::...|..||.::..|..|:::|:|||.|:..||...:..
 Frog    33 WVQTHKKIYKN-EGEE-LARRLIWEDTLKFIMLHNLEYSMGLHTYEVGMNHLGDMVAEEMTDKQM 95

  Fly    74 KKVP 77
            ..:|
 Frog    96 NFIP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 23/58 (40%)
LOC594890NP_001076821.2 Inhibitor_I29 30..89 CDD:214853 22/57 (39%)
Peptidase_C1A 118..331 CDD:239068
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.