DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and cts12

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_021329137.1 Gene:cts12 / 567046 ZFINID:ZDB-GENE-050208-336 Length:349 Species:Danio rerio


Alignment Length:70 Identity:23/70 - (32%)
Similarity:39/70 - (55%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EWVEYKSKFDKNYEAE-EDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQR 71
            ||..:|.|.:.:|:.| ||:.|:.|:..:..:|.::|..|..|...:||.:|...|||..|:.:.
Zfish    40 EWNLWKKKHEISYDEESEDVHRKTIWETNMQKIWKNNNDFSFGLSMFKMAMNKYGDLTSVEYKRL 104

  Fly    72 CGKKV 76
            .|.|:
Zfish   105 LGSKI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 19/59 (32%)
cts12XP_021329137.1 Inhibitor_I29 41..101 CDD:311939 19/59 (32%)
Peptidase_C1A 135..347 CDD:239068
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.