DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and Ctsll3

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_006253592.1 Gene:Ctsll3 / 498691 RGDID:1560071 Length:330 Species:Rattus norvegicus


Alignment Length:65 Identity:20/65 - (30%)
Similarity:33/65 - (50%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |..|.|:|:|..|.|...|:..:|.::..:...|..||..:.||:..:.:.:|...|||..||.:
  Rat    26 DTVWEEWKTKHGKTYNTNEEGQKRAVWENNMKMINLHNEDYLKGKHGFSLEMNAFGDLTNTEFRE 90

  Fly    71  70
              Rat    91  90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 17/58 (29%)
Ctsll3XP_006253592.1 Inhibitor_I29 29..87 CDD:214853 17/57 (30%)
Peptidase_C1 114..329 CDD:278538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10169
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.