DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and Ctla2a

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_006253587.1 Gene:Ctla2a / 498690 RGDID:1565540 Length:188 Species:Rattus norvegicus


Alignment Length:67 Identity:30/67 - (44%)
Similarity:44/67 - (65%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |.||.|:|.||.|.|..:|:..||.::.|||..||.||..:::|:.::.||:|..:|||.|||.:
  Rat    13 DTEWEEWKKKFGKTYSPDEERHRRAVWEESKKTIEAHNADYKQGKTSFYMGLNQFSDLTTEEFRR 77

  Fly    71 RC 72
            .|
  Rat    78 NC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 25/58 (43%)
Ctla2aXP_006253587.1 Inhibitor_I29 16..74 CDD:214853 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10169
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5221
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009916
OrthoInspector 1 1.000 - - oto98323
orthoMCL 1 0.900 - - OOG6_134509
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.