DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and ctss

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001005695.1 Gene:ctss / 448203 XenbaseID:XB-GENE-953011 Length:333 Species:Xenopus tropicalis


Alignment Length:75 Identity:28/75 - (37%)
Similarity:46/75 - (61%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAE-EDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFA 69
            |..|:.:|:..:|:||.| |||.||..:.::...:..||.::..|..|:::|:|||||:|.||..
 Frog    24 DNHWLLWKNTHNKDYEDEIEDLQRRITWEKNLNLVNMHNLEYSMGMHTYELGMNHLADMTSEEIK 88

  Fly    70 QR-CGKKVPP 78
            .: .|..:||
 Frog    89 SKLTGLILPP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 23/59 (39%)
ctssNP_001005695.1 Inhibitor_I29 27..87 CDD:462410 23/59 (39%)
Peptidase_C1 118..331 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.