DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and ctsv

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001004869.1 Gene:ctsv / 448179 XenbaseID:XB-GENE-966214 Length:335 Species:Xenopus tropicalis


Alignment Length:65 Identity:21/65 - (32%)
Similarity:36/65 - (55%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |..|..:|:...|:|..:|:..||.::.::...||.||.:...|:.:..:|:|...|:|.|||.|
 Frog    26 DNHWNLWKNWHKKSYAPKEEGWRRVLWEKNLRMIEFHNLEHSLGKHSHSLGMNQFGDMTNEEFRQ 90

  Fly    71  70
             Frog    91  90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 17/58 (29%)
ctsvNP_001004869.1 Inhibitor_I29 29..87 CDD:214853 16/57 (28%)
Peptidase_C1 115..334 CDD:306594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11720
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.