powered by:
Protein Alignment cer and ctsl.1
DIOPT Version :9
Sequence 1: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002368.1 |
Gene: | ctsl.1 / 436641 |
ZFINID: | ZDB-GENE-040718-61 |
Length: | 334 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 20/68 - (29%) |
Similarity: | 41/68 - (60%) |
Gaps: | 1/68 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 VSDEEWVEYKSKFDKNY-EAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEE 67
:.|.|:..:|.||.|:| .|||:..|:..:..::..:..||...::|..::::|:.:.||::.||
Zfish 21 LEDMEFHAWKLKFGKSYRSAEEESHRQLTWLTNRKLVLVHNMMADQGLKSYRLGMTYFADMSNEE 85
Fly 68 FAQ 70
:.|
Zfish 86 YRQ 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.