DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cer and CG11459

DIOPT Version :9

Sequence 1:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_001287191.1	Gene:	CG11459 / 40741	FlyBaseID:	FBgn0037396	Length:	336	Species:	Drosophila melanogaster

Alignment Length:	62	Identity:	23/62 - (37%)
Similarity:	39/62 - (62%)	Gaps:	1/62 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MSLVSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLAD 62
            ::.|||.||.:||:|::|.|. ..|...|.:|.:....:|.||:.:.:|:|.:|||:|..:|
  Fly    22 LTAVSDTEWDQYKAKYNKQYR-NRDKYHRALYEQRVLAVESHNQLYLQGKVAFKMGLNKFSD 82

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	19/54 (35%)
CG11459	NP_001287191.1	Inhibitor_I29	30..85	CDD:285458	19/54 (35%)
CG11459	NP_001287191.1	Peptidase_C1A	120..334	CDD:239068
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	49	1.000	Domainoid score	I11780
eggNOG	1	0.900	-	-		E1_COG4870
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	2.810