DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cer and CG6347

DIOPT Version :9

Sequence 1:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_610906.1	Gene:	CG6347 / 36531	FlyBaseID:	FBgn0033874	Length:	352	Species:	Drosophila melanogaster

Alignment Length:	59	Identity:	20/59 - (33%)
Similarity:	32/59 - (54%)	Gaps:	0/59 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 KNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRCGKKV 76
            |.|..||.:.|..|:|...:.|...|:..:.|...:::|:|.|||:|.:|.|...|.|:
  Fly    47 KVYSDEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATLLGSKI 105

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	16/49 (33%)
CG6347	NP_610906.1	Inhibitor_I29	38..97	CDD:285458	16/49 (33%)
CG6347	NP_610906.1	Peptidase_C1A	131..350	CDD:239068
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4870
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.810