DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cer and Ctsf

DIOPT Version :9

Sequence 1:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_001029282.1	Gene:	Ctsf / 361704	RGDID:	1308181	Length:	462	Species:	Rattus norvegicus

Alignment Length:	59	Identity:	16/59 - (27%)
Similarity:	34/59 - (57%)	Gaps:	4/59 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 EYKSKFDKNYEAEEDLM-RRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
            ::.:.:::.||:.|:.. |..::|.:..|.:: .:..::|  |.:.||...:|||.|||
  Rat   167 DFMTTYNRTYESREEAQWRLTVFARNMIRAQK-IQALDRG--TAQYGITKFSDLTEEEF 222

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	14/57 (25%)
Ctsf	NP_001029282.1	Inhibitor_I29	165..221	CDD:214853	13/56 (23%)
Ctsf	NP_001029282.1	Peptidase_C1	249..460	CDD:395062
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG4870
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900