powered by:
Protein Alignment cer and Ctsf
DIOPT Version :9
Sequence 1: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001029282.1 |
Gene: | Ctsf / 361704 |
RGDID: | 1308181 |
Length: | 462 |
Species: | Rattus norvegicus |
Alignment Length: | 59 |
Identity: | 16/59 - (27%) |
Similarity: | 34/59 - (57%) |
Gaps: | 4/59 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 EYKSKFDKNYEAEEDLM-RRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
::.:.:::.||:.|:.. |..::|.:..|.:: .:..::| |.:.||...:|||.|||
Rat 167 DFMTTYNRTYESREEAQWRLTVFARNMIRAQK-IQALDRG--TAQYGITKFSDLTEEEF 222
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.