DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and Ctsj

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_058817.1 Gene:Ctsj / 29174 RGDID:69241 Length:334 Species:Rattus norvegicus


Alignment Length:63 Identity:22/63 - (34%)
Similarity:39/63 - (61%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
            |.||.::|:|:.|:|...|:.::|.::.|:...|:.||::...|:..:.|.:|..||.|.|||
  Rat    26 DAEWQDWKTKYAKSYSPVEEELKRAVWEENLKMIQLHNKENGLGKNGFTMEMNAFADTTGEEF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 18/58 (31%)
CtsjNP_058817.1 Inhibitor_I29 29..87 CDD:214853 17/57 (30%)
Peptidase_C1 114..331 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.