DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and cpr-2

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_507186.3 Gene:cpr-2 / 185355 WormBaseID:WBGene00000782 Length:326 Species:Caenorhabditis elegans


Alignment Length:55 Identity:12/55 - (21%)
Similarity:20/55 - (36%) Gaps:10/55 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KNYEAEEDLMR-RRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQR 71
            :||....:.|. |.::.:..|...:..|..|:         ..:.|.||..|..|
 Worm    45 ENYAVTHEKMHTRSMHEKFNAPFPDEFRATER---------EFVLDATPLNFDAR 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 10/50 (20%)
cpr-2NP_507186.3 Peptidase_C1A_CathepsinB 84..323 CDD:239111 3/7 (43%)

Return to query results.
Submit another query.