DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and cpr-3

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_506790.1 Gene:cpr-3 / 180033 WormBaseID:WBGene00000783 Length:370 Species:Caenorhabditis elegans


Alignment Length:45 Identity:12/45 - (26%)
Similarity:21/45 - (46%) Gaps:8/45 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IEEHNR------KFEKGEVTWKMGINHLADLTPEEFAQRCGKKVP 77
            :.|||.      ||:..:|.:...:...:|:..|.|.:  |:.||
 Worm    47 VAEHNEISEFEMKFKVMDVKFAEPLEKDSDVASELFVR--GEIVP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 8/34 (24%)
cpr-3NP_506790.1 Peptidase_C1A_CathepsinB 93..334 CDD:239111
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.