powered by:
Protein Alignment cer and F32H5.1
DIOPT Version :9
Sequence 1: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_506310.1 |
Gene: | F32H5.1 / 179815 |
WormBaseID: | WBGene00009347 |
Length: | 356 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 33/71 - (46%) |
Gaps: | 9/71 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 VSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKG--EVTWKMG-INHLADLTP 65
:|..:...|.:|..|.::||.. |..:.|..||.: :.||.|. ||:.|.| .|.|.|: |
Worm 35 LSGSDLTSYVNKKQKLWKAETS---RMTFQEKMARAK--SIKFIKSNDEVSEKTGNDNVLVDI-P 93
Fly 66 EEFAQR 71
..|..|
Worm 94 SSFDSR 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.