DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and tag-196

DIOPT Version :10

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_505215.2 Gene:tag-196 / 179240 WormBaseID:WBGene00007055 Length:477 Species:Caenorhabditis elegans


Alignment Length:68 Identity:14/68 - (20%)
Similarity:34/68 - (50%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQRCG 73
            ::::..:.:|.|..:.::::|....:..|::....:|.|:|...:  |....:|:|..||     
 Worm   174 FLDFVDRHEKKYTNKREVLKRFRVFKKNAKVIRELQKNEQGTAVY--GFTKFSDMTTMEF----- 231

  Fly    74 KKV 76
            ||:
 Worm   232 KKI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:462410 10/58 (17%)
tag-196NP_505215.2 CY 23..>91 CDD:447698
Inhibitor_I29 174..231 CDD:462410 10/58 (17%)
Peptidase_C1 264..475 CDD:425470
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.