DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and CTSV

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001188504.1 Gene:CTSV / 1515 HGNCID:2538 Length:334 Species:Homo sapiens


Alignment Length:68 Identity:22/68 - (32%)
Similarity:39/68 - (57%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |.:|.::|:...:.|.|.|:..||.::.::...||.||.::.:|:..:.|.:|...|:|.|||.|
Human    26 DTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQ 90

  Fly    71 RCG 73
            ..|
Human    91 MMG 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 17/58 (29%)
CTSVNP_001188504.1 Inhibitor_I29 29..87 CDD:214853 16/57 (28%)
Peptidase_C1 114..332 CDD:306594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11780
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.