DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and Ctsc

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_034112.3 Gene:Ctsc / 13032 MGIID:109553 Length:462 Species:Mus musculus


Alignment Length:67 Identity:14/67 - (20%)
Similarity:29/67 - (43%) Gaps:12/67 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KNYE--AEEDLMRRRIYAESKAR------IEEHNRKFEKGEVTWK----MGINHLADLTPEEFAQ 70
            |.||  :..||:||..:::...|      .:|..::......:|.    .|:|:::.:..:|...
Mouse   191 KEYEKMSLRDLIRRSGHSQRIPRPKPAPMTDEIQQQILNLPESWDWRNVQGVNYVSPVRNQESCG 255

  Fly    71 RC 72
            .|
Mouse   256 SC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 12/61 (20%)
CtscNP_034112.3 CathepsinC_exc 26..138 CDD:285926
Pox_I6 168..>204 CDD:252691 5/12 (42%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 5/28 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.