powered by:
Protein Alignment cer and Ctla2a
DIOPT Version :9
Sequence 1: | NP_611420.1 |
Gene: | cer / 37229 |
FlyBaseID: | FBgn0034443 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_031822.2 |
Gene: | Ctla2a / 13024 |
MGIID: | 88554 |
Length: | 137 |
Species: | Mus musculus |
Alignment Length: | 67 |
Identity: | 31/67 - (46%) |
Similarity: | 45/67 - (67%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
|.||.|:|:||.|.|...|:..||.::.|:|.:||.||..:|:|:.::.||:|..:|||||||..
Mouse 37 DNEWKEWKTKFAKAYNLNEERHRRLVWEENKKKIEAHNADYEQGKTSFYMGLNQFSDLTPEEFKT 101
Fly 71 RC 72
.|
Mouse 102 NC 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
63 |
1.000 |
Domainoid score |
I10182 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
72 |
1.000 |
Inparanoid score |
I5283 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0009916 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto94819 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_134509 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4906 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.790 |
|
Return to query results.
Submit another query.