Protein Alignment cer and Ctla2a

DIOPT Version :9

• Sequence 1: NP_611420.1
• Gene: cer / 37229
• FlyBaseID: FBgn0034443
• Length: 79
• Species: Drosophila melanogaster
• Sequence 2: NP_031822.2
• Gene: Ctla2a / 13024
• MGIID: 88554
• Length: 137
• Species: Mus musculus
• Alignment Length: 67
• Identity: 31/67 - (46%)
• Similarity: 45/67 - (67%)
• Gaps: 0/67 - (0%)

  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |.||.|:|:||.|.|...|:..||.::.|:|.:||.||..:|:|:.::.||:|..:|||||||..
Mouse    37 DNEWKEWKTKFAKAYNLNEERHRRLVWEENKKKIEAHNADYEQGKTSFYMGLNQFSDLTPEEFKT 101

  Fly    71 RC 72
            .|
Mouse   102 NC 103

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	26/58 (45%)
Ctla2a	NP_031822.2	2 X 3 AA tandem repeats of E-W-K	39..44		3/4 (75%)
		Inhibitor_I29	40..98	CDD:214853	25/57 (44%)
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	114..137

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	63	1.000	Domainoid score	I10182
eggNOG	1	0.900	-	-		E1_COG4870
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	72	1.000	Inparanoid score	I5283
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0009916
OrthoInspector	1	1.000	-	-		oto94819
orthoMCL	1	0.900	-	-		OOG6_134509
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R4906
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	9	8.790