DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and Cts3

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_081182.2 Gene:Cts3 / 117066 MGIID:2151929 Length:332 Species:Mus musculus


Alignment Length:65 Identity:22/65 - (33%)
Similarity:38/65 - (58%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEF 68
            :.|.||.::|.|:.|.|..||:..:|.::.|:..:|:.||.:...|:..:.|.:|...|:|.|||
Mouse    24 ILDAEWQKWKIKYGKTYSLEEEGQKRAVWEENMKKIKLHNGENGLGKHGFTMEMNAFGDMTLEEF 88

  Fly    69  68
            Mouse    89  88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 18/58 (31%)
Cts3NP_081182.2 Inhibitor_I29 29..87 CDD:214853 17/57 (30%)
Peptidase_C1A 115..330 CDD:239068
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10182
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.