DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cer and si:dkey-26g8.4

DIOPT Version :9

Sequence 1:NP_611420.1 Gene:cer / 37229 FlyBaseID:FBgn0034443 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_003199634.1 Gene:si:dkey-26g8.4 / 100537665 ZFINID:ZDB-GENE-121214-36 Length:335 Species:Danio rerio


Alignment Length:75 Identity:30/75 - (40%)
Similarity:46/75 - (61%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFAQ 70
            |:.|..:||:..|:|..:.::.||.|:.|:..:||:||.::..|..|:|||:|...|:|.|||.|
Zfish    25 DDHWNSWKSQHGKSYHEDVEVGRRMIWEENLRKIEQHNFEYSYGNHTFKMGMNQFGDMTNEEFRQ 89

  Fly    71 RC-GKKVPPN 79
            .. |.|..||
Zfish    90 AMNGYKHDPN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cerNP_611420.1 Inhibitor_I29 9..68 CDD:400519 22/58 (38%)
si:dkey-26g8.4XP_003199634.1 Inhibitor_I29 28..86 CDD:214853 21/57 (37%)
Peptidase_C1 115..334 CDD:278538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.