DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cer and LOC100124852

DIOPT Version :9

Sequence 1:	NP_611420.1	Gene:	cer / 37229	FlyBaseID:	FBgn0034443	Length:	79	Species:	Drosophila melanogaster
Sequence 2:	NP_001096284.1	Gene:	LOC100124852 / 100124852	-ID:	-	Length:	333	Species:	Xenopus tropicalis

Alignment Length:	61	Identity:	26/61 - (42%)
Similarity:	37/61 - (60%)	Gaps:	2/61 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 WVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGEVTWKMGINHLADLTPEEFA 69
            ||:...|..||  |||:..||.|:.|:...|..||.::..|..|:::|:|||.|:|.||.|
Frog    33 WVKTHQKTYKN--AEEERARRTIWEETLKFISAHNLEYSLGLHTYEVGMNHLGDMTGEEVA 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cer	NP_611420.1	Inhibitor_I29	9..68	CDD:400519	24/58 (41%)
LOC100124852	NP_001096284.1	Inhibitor_I29	30..89	CDD:214853	23/57 (40%)
LOC100124852	NP_001096284.1	Peptidase_C1A	120..331	CDD:239068
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910