DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and TRE1

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_015149.1 Gene:TRE1 / 855927 SGDID:S000006097 Length:783 Species:Saccharomyces cerevisiae


Alignment Length:483 Identity:105/483 - (21%)
Similarity:165/483 - (34%) Gaps:151/483 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QANLYDFE-AIG--------TKVVGSDENE------HKTVQF-LLKELNL---IKDNIQEDLFDM 126
            :.|..||| |||        .:.:|.:|.:      .|..:| :..|.|:   :|.|:.:.|..|
Yeast    23 ELNSQDFEQAIGMPSEPPVYVEEMGMEEPQAPEAFSEKVQRFRMCFENNVVIPVKKNVVDPLAQM 87

  Fly   127 EIDLQYAYGAYVKWNLVNMYQGIQNVVVKLTPKGTTSENYILVNSHF-------DSQPTSPSTGD 184
             |.|     |..|::|  ....|.||:|      .....||::.|..       |..|...:.|.
Yeast    88 -ISL-----ASEKFDL--FLSKIGNVMV------MRRIFYIMMMSIIAALIIASDRLPNGKARGS 138

  Fly   185 DGHMVVSILEVLRVISSRRKS-----FEHPIIFLINGSEENSLQASHGFIAYHKWAKNCKAVINL 244
            :|    |..:...::...|||     .|..:.::   |....:..:.|..|...:.|.     :.
Yeast   139 NG----SFSDHDLLLQYARKSIDLSKIERDLEYI---SSMPHMSGTSGDAAIRHYIKE-----SF 191

  Fly   245 DAAG---SGGRELM-FQSGPNNPWLVKIYKDGAKHYFSTTMAEEIF-------QTGLVP-SYT-- 295
            |..|   :|..|.| :.:.|.|..| ::|.......|...:.||.|       |...:| .|.  
Yeast   192 DKNGIRLAGEEEFMAYSNYPGNVSL-RVYSKDDTEGFDIPLNEENFNPMSHNGQLNNIPVIYANK 255

  Fly   296 -----------------DFDIFVEYGN------LIGLDIGQCINGFVYHTKYDRIDVIPRAAL-- 335
                             ||.:.|.||:      |...:.|.....|:.....|..|||...::  
Yeast   256 ASLDDMASMQDQGLLNGDFILLVHYGDYVFQQMLTAQEYGAKAIIFISEPYQDNKDVIQMKSVAL 320

  Fly   336 --QNTGDNLL----GLVQTLSNASELR--------DLSANPTGNTIFFDVLGLYLISYSADVGVK 386
              ..|||.|.    |.::...:|:|.:        .:|||.          |..:::..:|.|||
Yeast   321 PQYGTGDALTPEWEGSIRDPIDATEAKCLPKIPSIPISANQ----------GDKILAILSDTGVK 375

  Fly   387 LNYAVAAAAIILIYISLL---RIAEKSSV--------SSEQILSTFILVLVVQLIAFVLALALPL 440
            .:..:.:.::....:.||   .|.|:..|        .|||             ....:.:|.|.
Yeast   376 FSNNLFSGSLNDCRLDLLVQTAIRERHPVHDIVGKIEGSEQ-------------AGRAIVIAAPR 427

  Fly   441 LVAYGLDKYGLSLSYFATPSL--LIGLY 466
            ..|    .||.....|.|..|  ||.||
Yeast   428 NSA----SYGTMYPSFGTVVLLSLIQLY 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 81/381 (21%)
TRE1NP_015149.1 PA 221..374 CDD:333703 31/162 (19%)
M28_PMSA_TfR_like 402..617 CDD:349871 16/67 (24%)
TFR_dimer 642..769 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.