DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and TRE2

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_014899.1 Gene:TRE2 / 854430 SGDID:S000005782 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:62/310 - (20%)
Similarity:100/310 - (32%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NLYDFEAIGTKVVGSDENEHKTVQFLLKELNLIKDNIQEDL---FDMEIDLQYAYGAYVKWNLVN 144
            :|.|...:|.......||.....:..::...|:|.....:.   ||:.:|....||.:..: |.|
Yeast   517 SLIDISQLGIPFAEKYENGKTRGELSIETHPLLKKFFNRNAHGNFDISVDNVQHYGDWTPF-LAN 580

  Fly   145 MYQGIQNVVV-------KLTPKGTTSENYILVNSHFDSQPTSPSTG--------------DDGHM 188
               ||...|:       :.||..|:.:.:..|....:.:....|..              ||..:
Yeast   581 ---GIPVSVISSDSTRNRDTPTETSEDKFERVEKILEDEQNQQSVKDLLVYLLHISMELIDDPLL 642

  Fly   189 VVSILEVLRVISSRRKSFEHPIIFLIN--------------GSE--------ENSLQASHG---- 227
            ...|:..:..|..|.:..|......:|              |||        || :..|||    
Yeast   643 HFDIISYVEDIDERLQRLEQAYPEKLNFTSIIKGLLFWKKIGSEWASWTQGWEN-IVWSHGDGIE 706

  Fly   228 --FIAYHKWAKNCKAVINLDAAGSGGRELMFQSG-PNNPWLVKIYKDGAKHYFSTTMAEE----- 284
              .::.::|..| |.:.|:      ||.....:| ||.    ..||:   ..|..|:.:|     
Yeast   707 PSLLSINRWTWN-KKLTNI------GRRTCSPAGLPNR----SFYKN---VLFGPTLIQEDKSKN 757

  Fly   285 ----IFQT--GLVPSYTDFD--------------------IFVEYGNLIG 308
                .|.|  |::.:..|.|                    :|||..|.||
Yeast   758 GGNVDFWTFPGVMDAIYDDDWKRAQEQIDLIGKVLHQSAALFVEETNDIG 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 62/310 (20%)
TRE2NP_014899.1 PA 249..392 CDD:238300
M28_PMSA_TfR_like 417..643 CDD:349871 24/129 (19%)
TFR_dimer 668..799 CDD:398094 28/145 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.