DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and VPS70

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_012660.1 Gene:VPS70 / 853590 SGDID:S000003887 Length:811 Species:Saccharomyces cerevisiae


Alignment Length:413 Identity:79/413 - (19%)
Similarity:143/413 - (34%) Gaps:127/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RLPE-PLTVEDASKGGFIAERAQ---------ANLYDFEAIGTKVVGSDE-NEHKTVQFLLKELN 113
            |:|. |::..|...   |.||..         :|:.||.:........|: :.|..:.:.:||::
Yeast   364 RIPSVPMSARDVQP---ILERLNGRGFQIGPGSNIKDFGSFTGPSSSIDKVHLHNELTYNIKEMS 425

  Fly   114 LIKDNIQEDLFDMEIDLQYAYGAYVKWNLVNMYQGIQNVVVKLTPKGTTSENYILVNSHFDSQPT 178
            .::.:|                                       .|..:|..|::.:|.||..:
Yeast   426 SVEVSI---------------------------------------PGIFTEGEIIIGAHRDSLAS 451

  Fly   179 SPSTGDDGHMVVSILEVLRVISSRRKSFEH------PIIFLINGSEENSLQASHGFIAYHKWAKN 237
            | |.||.......:||:.|.:|   |..:|      ||..:....|.:.|..|..:...|.....
Yeast   452 S-SAGDANSGSAILLEIARGMS---KLLKHGWKPLRPIKLISWDGERSGLLGSTDYAEAHAAILR 512

  Fly   238 CKAVI--NLDAAGSGGRELMFQSGPN-----NPWLVKIYKDGAK--------------HYFSTTM 281
            .:|::  |||.|         .||.|     ||.|..:..:.||              |:..|:.
Yeast   513 RRALVYLNLDNA---------ISGTNFHCKANPLLQDVIYEAAKLTEFNGHEDWSLFDHWKYTSN 568

  Fly   282 AEEIFQTGLVPSYTDFDIFVEYGNLIGLDIGQC------INGFVYHT-----------KYDRIDV 329
            |......|| .|||.|...      :|:.....      .:|.|||:           |:...|.
Yeast   569 ATISLLDGL-SSYTSFQYH------LGVPAAHFQFNANDTSGAVYHSNSVFDSPTWLEKFTNSDY 626

  Fly   330 IPRAALQNTGDNLLGLVQTLSNASELRDLSANPTGNTIFFDVLGLYLISYSADVGVKLNYAVAAA 394
                .|.||....:||...:.:.:||...:.:     ::...:..:.|::.:::...........
Yeast   627 ----KLHNTMAMFVGLTTLMLSENELARFNTH-----VYLKKIYNWYIAWHSNLSSAFPQDDEVN 682

  Fly   395 AIILIYISLLRIA-EKSSVSSEQ 416
            ::....:.||::| ::.|:..:|
Yeast   683 SLAKRVLDLLKVATQEDSIQFDQ 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 70/360 (19%)
VPS70NP_012660.1 Zinc_peptidase_like 135..>187 CDD:417508
PA_GCPII_like 187..413 CDD:239036 11/51 (22%)
M28_PMSA_TfR_like 419..649 CDD:349871 60/292 (21%)
TFR_dimer <731..799 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.