DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and APE3

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:64/268 - (23%)
Similarity:103/268 - (38%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ASKGGFIAERAQANLYDFEAIGTKVVGSDENEHKTVQFLLKE--------LNLIKDNIQEDLFDM 126
            |.|.||.|    ..:||.|.      .|.|..|.|:....|.        ..:.|..|.....::
Yeast   222 AGKFGFTA----VVIYDNEP------KSKEGLHGTLGEPTKHTVATVGVPYKVGKKLIANIALNI 276

  Fly   127 EIDLQYAYGAYVKWNLVNMYQGIQNVVVKLTPKGTTSENYILVNSHFDSQPTSPSTGDDGHMVVS 191
            :..|.:|..:||:      :...||::.  ..|....:|.:.:.:|.||....|...|||...:|
Yeast   277 DYSLYFAMDSYVE------FIKTQNIIA--DTKHGDPDNIVALGAHSDSVEEGPGINDDGSGTIS 333

  Fly   192 ILEVLRVISSRRKSFEHPIIFLINGSEENSLQASHGFIAYH-KWAKNCKAVINLD----AAGSGG 251
            :|.|.:.::..:  ..:.:.|....:||..|..|: |.||: ...:|.|..:.:|    |:.:..
Yeast   334 LLNVAKQLTHFK--INNKVRFAWWAAEEEGLLGSN-FYAYNLTKEENSKIRVFMDYDMMASPNYE 395

  Fly   252 RELMFQSGPNNP----WLVKIYKDGAK-HYFSTTMAEEIFQTGLVPSYTDFDIFVEYGNLI--GL 309
            .|:...:...||    .|..:|.|..| |:.:.|         |||    ||...:|...|  |:
Yeast   396 YEIYDANNKENPKGSEELKNLYVDYYKAHHLNYT---------LVP----FDGRSDYVGFINNGI 447

  Fly   310 DIGQCING 317
            ..|....|
Yeast   448 PAGGIATG 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 63/266 (24%)
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 64/268 (24%)
PA_ScAPY_like 155..284 CDD:239045 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.