DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and Naaladl1

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_113947.1 Gene:Naaladl1 / 83568 RGDID:620987 Length:745 Species:Rattus norvegicus


Alignment Length:412 Identity:88/412 - (21%)
Similarity:152/412 - (36%) Gaps:110/412 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NLYDFEAIGTKVVGSDENEHKTVQFLLKELNLIKDNIQEDLFDMEIDLQYAYGAYVKWN------ 141
            |:..|..|.|:.:|.::.::     ||..||   .....|.:...:..:|..|...:.|      
  Rat   279 NISGFPPIPTQPIGFEDAKN-----LLCNLN---GTSAPDSWQGALGCEYKLGPGFEPNGNFPAG 335

  Fly   142 ---LVNMYQGIQ----NVVVKLTPKGTTSENYILVNSHFDS---QPTSPSTGDDGHMVVSILEVL 196
               .|::|..::    :.|:.:.......:.|::..:|.||   ....||:|     ...:||:.
  Rat   336 SEVKVSVYNRLELRNSSNVLGIIQGAVEPDRYVIYGNHRDSWVHGAVDPSSG-----TAVLLEIS 395

  Fly   197 RVISS-RRKSFEHP---IIFLINGSEENSLQASHGFIA--YHKWAKNCKAVINLDAAGSGGRELM 255
            ||:.: .:|....|   |||...|:||..|..|..|..  ..|..:.....||:|.:......|.
  Rat   396 RVLGTLLKKGTWRPRRSIIFASWGAEEFGLIGSTEFTEEFLSKLQERTVTYINVDISVFSNATLR 460

  Fly   256 FQ----------------SGPNNPWLVKIYKDGAKHYFSTTMAEEIFQTGLVPSY------TDFD 298
            .|                |.|.:..| .||.:..::   |..:..::  |||||.      :|:.
  Rat   461 AQGTPPVQSVIFSATKEISAPGSSGL-SIYDNWIRY---TNRSSPVY--GLVPSMGTLGAGSDYA 519

  Fly   299 IFVEYGNLIGLDIGQCINGF--------VYHTKYDRIDVIPR----------AALQNTGDNLLGL 345
            .|:.:..:..:|:....:..        .|||.:|..|.:.:          |..:..|..||.|
  Rat   520 SFIHFLGITSMDLAYTYDRSKTSARIYPTYHTAFDTFDYVEKFLDPGFSSHQAVARTAGSVLLRL 584

  Fly   346 VQTL------SNASE-----LRDLSANPTGNTIFFDVLGLYLISYSADVGVKL----NYAVAAAA 395
            ..:|      |:.||     |:....|          ||..|.|::..:|..:    .:..||||
  Rat   585 SDSLFLPLNVSDYSETLQSFLQAAQEN----------LGALLESHNISLGPLVTAVEKFKAAAAA 639

  Fly   396 IILIYISLLRIAEKSSVSSEQI 417
            :....::|    :|||....|:
  Rat   640 LNQHILTL----QKSSPDPLQV 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 77/368 (21%)
Naaladl1NP_113947.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 119..331 CDD:239036 13/59 (22%)
M28_PSMA_like <353..592 CDD:349942 54/249 (22%)
TFR_dimer 621..740 CDD:367885 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.