DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and AT4G07670

DIOPT Version :10

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_192510.1 Gene:AT4G07670 / 826236 AraportID:AT4G07670 Length:280 Species:Arabidopsis thaliana


Alignment Length:103 Identity:25/103 - (24%)
Similarity:43/103 - (41%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NLVNMYQGIQNVVVKLTPKGTTSENYILVNSHFDS---QPTSPSTGDDGHMVVS------ILEVL 196
            ||..:...||||:..:..: ...:.|:::.:|.|:   :...|::|....|..|      |.:.|
plant   156 NLSYIVTKIQNVIGVIEGE-EEPDRYVILRNHRDTWTFRAVDPNSGTAVLMEASKSYLQHIAQRL 219

  Fly   197 RVISSRRKSFEHPIIFLINGSEENSLQASHGFIAYHKW 234
            ..:..|.......||.....:||..|.:|...|:|  |
plant   220 DKLQKRGWKPRRTIILCNWDAEEYGLVSSLSEISY--W 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:349872 25/103 (24%)
AT4G07670NP_192510.1 PA <10..150 CDD:333703
Zinc_peptidase_like <163..>248 CDD:472712 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.