DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and Tfr2

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:XP_030110515.1 Gene:Tfr2 / 50765 MGIID:1354956 Length:840 Species:Mus musculus


Alignment Length:326 Identity:61/326 - (18%)
Similarity:125/326 - (38%) Gaps:84/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ENYILVNSHFDSQPTSPSTGDDGHMVVSILEVLRVISSRRKSFEHP---IIFLI-NGSEENSLQA 224
            ::|:::.:..|:  ..|...........:||::|..||...:...|   ::|:. :|.:..|:.|
Mouse   461 DHYVVIGAQRDA--WGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGDFGSVGA 523

  Fly   225 SHGFIAYHKWAKNCKAVINLDAA----------GSGGRELMFQSGPNNPWLVKIYKDGAK----- 274
            :       :|.:...:|::|.|.          |.|    .|.: ..:|.||.:.::..|     
Mouse   524 T-------EWLEGYLSVLHLKAVVYVSLDNSVLGDG----KFHA-KTSPLLVSLIENILKQVDSP 576

  Fly   275 HYFSTTMAEEIFQTGLVPSYTDFDI------------FVEYGNLIGLDIGQCINGFVY---HTKY 324
            ::...|:.|::..|.  ||: |.::            |..:..:..::.....:..||   |||.
Mouse   577 NHSGQTLYEQVALTH--PSW-DAEVIQPLPMDSSAYSFTAFAGVPAVEFSFMEDDRVYPFLHTKE 638

  Fly   325 D-----------RIDVIPRAALQNTGDNLLGLVQTLSNASELRDLSANPTGNTIFFDVLGLYLIS 378
            |           |:..:.:|..|..|..|:.|     :...|..|.....|:.:...:..|.  .
Mouse   639 DTYENLHKMLRGRLPAVVQAVAQLAGQLLIRL-----SHDHLLPLDFGRYGDVVLRHIGNLN--E 696

  Fly   379 YSADV---GVKLNYAVAAAAIILIYISLLRIAEK------SSVSSEQILSTFILVLVVQLIAFVL 434
            :|.|:   |:.|.:..:|..      ..:|.|||      ||..:::.|.....|.::::..:.|
Mouse   697 FSGDLKERGLTLQWVYSARG------DYIRAAEKLRKEIYSSERNDERLMRMYNVRIMRVEFYFL 755

  Fly   435 A 435
            :
Mouse   756 S 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 47/259 (18%)
Tfr2XP_030110515.1 PA_TfR 248..438 CDD:239043
M28_TfR 446..679 CDD:349946 44/239 (18%)
TFR_dimer 706..830 CDD:367885 11/57 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.