DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and Naalad2

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_001100272.1 Gene:Naalad2 / 300384 RGDID:1305872 Length:778 Species:Rattus norvegicus


Alignment Length:429 Identity:91/429 - (21%)
Similarity:151/429 - (35%) Gaps:125/429 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YFAGGIVLF---WALLFIAVVKPLFYRL---PEPLTVEDASKGGFIAERAQANLYDFEAIGTKVV 95
            |||.|:..:   |.|...|..:.....|   .:|||      .|:.|:.....|...||:|...:
  Rat   262 YFAPGVQPYPKGWNLPGAAAQRGNVLNLNGAGDPLT------PGYPAKEYTFRLPVEEAVGIPNI 320

  Fly    96 GSDENEHKTVQFLLKELNLIKDNIQEDLFDMEIDLQY---------AYGAYVKWNL--VNMYQGI 149
            ......:...:.||:  ||......:..:...:::.|         .|...|:.::  :|....|
  Rat   321 PVHPIGYNDAERLLR--NLGGTAPPDQSWKGSLNVSYNIGPGFSGSEYSRKVRMHVHNINKITRI 383

  Fly   150 QNVVVKLTPKGTTS-ENYILVNSHFDS---QPTSPSTGDDGHMVVSILEVLRVISSRRKSF---- 206
            .||:.  |.:|:|. :.|:::..|.||   ....|:||         ..||:.|:   :||    
  Rat   384 YNVIG--TIRGSTEPDRYVILGGHRDSWVFGGIDPTTG---------TAVLQEIA---RSFGKLV 434

  Fly   207 ------EHPIIFLINGSEENSLQASHGFIAYHKWA-KNCK-------AVINLDAAGSGGRELMFQ 257
                  ...|||....:||      .|.:...:|| :|.|       |.||.|:|..|...|...
  Rat   435 NGGWKPRRTIIFASWDAEE------FGLLGSTEWAEENAKILQERSIAYINSDSAIEGNYTLRVD 493

  Fly   258 SGPNNPWLVKIYK---------DGAKHYFSTTMAEEIFQTGLVP------------SYTDFDIFV 301
            ..|....||  ||         ||   :.|.::.|...:....|            |.:||:   
  Rat   494 CTPLLHQLV--YKVAREISSPDDG---FESKSLYESWLEKDPSPENKERPRINKLGSGSDFE--- 550

  Fly   302 EYGNLIGLDIGQC----------INGF-VYHTKYDRIDVIPRAALQNTGDNLLGLVQTLSNASEL 355
            .|...:|:..|:.          .:.: ||||.|:..:                |||...:.:..
  Rat   551 AYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFE----------------LVQNFYDPTFK 599

  Fly   356 RDLSANPTGNTIFFDVLGLYLISYSADVGVKL--NYAVA 392
            :.||.......:.:::....:|.::.....|.  |||.:
  Rat   600 KQLSVAQLRGALVYELADCVVIPFNIQDYAKALKNYAAS 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 76/371 (20%)
Naalad2NP_001100272.1 Zinc_peptidase_like 86..>143 CDD:417508
PA_GCPII_like 148..374 CDD:239036 24/119 (20%)
M28_PSMA_like <382..623 CDD:349942 62/284 (22%)
TFR_dimer 655..774 CDD:398094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.