DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and CPQ

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:NP_057218.1 Gene:CPQ / 10404 HGNCID:16910 Length:472 Species:Homo sapiens


Alignment Length:459 Identity:90/459 - (19%)
Similarity:162/459 - (35%) Gaps:129/459 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FAGGIVLFWALLFIAVVK-PLFYRLPEPLTVEDASKGGF--------IAERAQANLYD-----FE 88
            |.||:.|.......|:.| .:..|..|.:..|.||.|..        :..:||...|:     .:
Human     8 FFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVD 72

  Fly    89 AIGTKVVGSDENEHKTVQFLLKELNLIKDNIQEDLFDMEIDLQYAYGAYVKWNLVNMYQGIQNVV 153
            .:|.::.|| :|..|.:|.:.:       |:|:|..: ::.|:..       .:.:..:|.::.|
Human    73 TVGPRLSGS-KNLEKAIQIMYQ-------NLQQDGLE-KVHLEPV-------RIPHWERGEESAV 121

  Fly   154 -----------------VKLTPKGTTSENYILVNSHFDSQPTSPSTGDDGHMVV---SILEVLRV 198
                             :...|:|.|:|  :||.:.||......|.. .|.:||   ..:...|.
Human   122 MLEPRIHKIAILGLGSSIGTPPEGITAE--VLVVTSFDELQRRASEA-RGKIVVYNQPYINYSRT 183

  Fly   199 ISSRRKSFEH-----PIIFLINGSEENSLQASH-GFIAYHKWA-KNCKAVINLDAAGSGGRELMF 256
            :..|.:....     .:..||......|:.:.| |...|.... |...|.|.::.|     |:|.
Human   184 VQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDA-----EMMS 243

  Fly   257 QSGPNNPWLVKIYKDGAKHYFST----TMAEEIFQTGLVPSYTDFDIFVEYGNLIGLDIGQCING 317
            :...:...:|...|.|||.|..|    |:||   .||  ..|.:..:.|. |:|...|:||    
Human   244 RMASHGIKIVIQLKMGAKTYPDTDSFNTVAE---ITG--SKYPEQVVLVS-GHLDSWDVGQ---- 298

  Fly   318 FVYHTKYDRIDVIPRAALQNTGDNLLGLVQTLSNASELRDLSANP----------------TGNT 366
                           .|:.:.|    |...:....|.::||...|                .|..
Human   299 ---------------GAMDDGG----GAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAF 344

  Fly   367 IFFDVLGLYLISYS----ADVGVKLNYAVAAAAIILIYISLLRIAEKSSVSSEQILSTFILVLVV 427
            .::.:..:.:.:||    :|.|..|...:....           :||:....|:::|....:.:.
Human   345 QYYQLHKVNISNYSLVMESDAGTFLPTGLQFTG-----------SEKARAIMEEVMSLLQPLNIT 398

  Fly   428 QLIA 431
            |:::
Human   399 QVLS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497 69/366 (19%)
CPQNP_057218.1 M28_Pgcp_like 47..449 CDD:193504 78/420 (19%)
PA_M28_2 130..256 CDD:240119 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.