DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10081 and LOC100330918

DIOPT Version :9

Sequence 1:NP_611418.1 Gene:CG10081 / 37226 FlyBaseID:FBgn0034441 Length:875 Species:Drosophila melanogaster
Sequence 2:XP_002665878.5 Gene:LOC100330918 / 100330918 -ID:- Length:354 Species:Danio rerio


Alignment Length:377 Identity:95/377 - (25%)
Similarity:158/377 - (41%) Gaps:65/377 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 VIPLAFNLLTTLHDRG------YSWTGILKIVQVAPFMYNSYLFYCFIVILTPMMGRFGVDTNPD 591
            |.||...:|...|.|.      ||...::.:  ..|:::..:|.:....|.||::||.|.:..||
Zfish     5 VFPLLSKVLLRTHFRAKGASLQYSVFYLMGL--SVPYVHIMFLIWVVFEIFTPILGRSGTEIPPD 67

  Fly   592 LIIGALTALGTILSMGFLILLVNMSRRSGFVLIGLLAVTAAGVYIASSTDIGFPY-------RPK 649
            :::.||..|..::...:|:.|:.:|..:..:|..|.:|.|. :::.....:.|||       |||
Zfish    68 VVLAALITLAAVILSSYLMHLLYLSCSTKRMLAALGSVFAV-MFVLVGCGLFFPYSADPSSPRPK 131

  Fly   650 TNVQRVPYLQVRRIFYEYDGTVSKDESGYLFNLQDRRGL------TPLLESNVDLTGLVNMTSDC 708
                ||......|:|:..||:|.:.:||...|..|..|:      .|.|..::        .:.|
Zfish   132 ----RVFVQHTTRVFHALDGSVERSDSGLWINSLDYTGMQHISAHVPQLNDSI--------RTRC 184

  Fly   709 AKYM-MCGMPLYDHRW---VEAMETTMW-LPRKNPVWTPAEPILKQLNKTVLADGQTVQFEFELT 768
            ...: .||.|     |   |:.:....| ||.  |..:|..|:..:|.....::..|::..||..
Zfish   185 QHTLPYCGFP-----WFLPVKFLVKKSWYLPA--PAVSPEAPLEFRLLSRQQSEWGTLRLSFEAK 242

  Fly   769 TSDHTSIFISPNEDVIISNWSFLKEYLTTNSP------PYHIYYSFGIDNTPLRFHIELKK--AD 825
            ...|.|:::.|.....:..|||     ...:|      .|.|:||.|.|....||.:|::.  :|
Zfish   243 GPTHMSLYLLPVSGASLIGWSF-----GDGTPRFDLSGEYFIFYSHGTDAPAWRFSLEVQPGVSD 302

  Fly   826 GVYTVPLFQMGIGAHYMHVKGDDESI----RLANSLPDYAVSIQWPAMYKKY 873
            ......|..:.|.|||.  .|.|:..    .|.::.||:|....|.:.|..|
Zfish   303 ASPDEGLLSLAISAHYF--SGPDKHSPPLHTLISTFPDWAFPSAWSSTYHMY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10081NP_611418.1 M28_Fxna_like 72..379 CDD:193497
LOC100330918XP_002665878.5 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D152011at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.