DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and TRE1

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_015149.1 Gene:TRE1 / 855927 SGDID:S000006097 Length:783 Species:Saccharomyces cerevisiae


Alignment Length:441 Identity:92/441 - (20%)
Similarity:152/441 - (34%) Gaps:110/441 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVRSRFDTCKNKISDEPIEDAVRSASSKKIKNQEQYLR-------------GPWYLATGFLLFWA 55
            |:|.|          .|:.|.|     .||:..||..|             |..|.:.|.::..:
Yeast   397 AIRER----------HPVHDIV-----GKIEGSEQAGRAIVIAAPRNSASYGTMYPSFGTVVLLS 446

  Fly    56 L--LFSAVVL-----PL--FYRIP-TGLTIEDASKGVFIAERAQ---SNLYKLAEIGTKVVGSDN 107
            |  |:..:|.     ||  .|.|. .|....:|.....:.:|.:   |.:|.:.::|...:..|:
Yeast   447 LIQLYQEMVYKFDWKPLRNIYFISFGGSEFNEAGATELMEKRTEALKSEIYTIIDVGQIGIWDDS 511

  Fly   108 NENKTVDYLMGLVNEIQENCLDDYFDIEVDLQEVSGSYIHWTMVNMYQGVQNIVIKLSP--KNTT 170
            | |..:.....||:..|:|.....|:::||.....|.   ||.. :.||:...:|. ||  .|..
Yeast   512 N-NLEIQCHPLLVDLFQKNMTSRKFNVKVDNVHQFGD---WTPY-LAQGIPVAIIS-SPGVMNRE 570

  Fly   171 STTYLLVNSHFDSKPTSPSAGDAGQMVVAILEVLRVMCSTKQAIRHPVVFLLNGAEENPLQASH- 234
            ...| .|...||...........|:::..|:  |.::..:.:.|..|.:         |...|: 
Yeast   571 HPIY-TVEDKFDFIKDKLRDKKKGEVLSEIM--LYLVEKSLELIDDPFI---------PFSISNY 623

  Fly   235 -GFI--TQHKWAKNCKVVLNLDAAGNGGSDIVFQTGPNSPWLVEKYKE-------NAPHYLATTM 289
             .|:  |.....|.|...:|.|....|.:     ...|:....||:|.       .|..|:..|:
Yeast   624 VDFLSTTLKDLQKECPDTVNFDEVFLGTT-----LWENTKLQFEKWKSEWTELMYGAGTYIEPTI 683

  Fly   290 ----------------AEEIFQTGILPSDTDFAIFVKYGNLIGLDMAKFINGFAYHTKYDQFSNI 338
                            ..:..:.|::  |..|...|.:|..:.:|....:..:.:....|..:..
Yeast   684 IAINRWSWNYLLSLIGVTQCLEEGLM--DRTFYKNVIFGPKLWVDKGDPLRSWTFPEIRDTIAIK 746

  Fly   339 PRGSIQNTGDNLLGLVRSIANSTELDNTEAYATGHAIFFDVLGLYFISYTE 389
            ...|:| ...|.||        |.|.||..|      |.:...|:.|:..|
Yeast   747 DWSSVQ-VQANTLG--------TILQNTARY------FLENKNLHGINTNE 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 68/338 (20%)
NrfD 398..638 CDD:304401
TRE1NP_015149.1 PA 221..374 CDD:333703
M28_PMSA_TfR_like 402..617 CDD:349871 52/237 (22%)
TFR_dimer 642..769 CDD:398094 27/148 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.