DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and TRE2

DIOPT Version :10

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_014899.1 Gene:TRE2 / 854430 SGDID:S000005782 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:32/159 - (20%)
Similarity:59/159 - (37%) Gaps:55/159 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IKNQEQYLRGPW--YLATGFLLFWALLFSAVVLPLFYRIPTGLTIEDASKGVFIAERAQSNLYKL 95
            :.|.:.|  |.|  :||.|                   ||..:...|:::..........:.::.
Yeast   565 VDNVQHY--GDWTPFLANG-------------------IPVSVISSDSTRNRDTPTETSEDKFER 608

  Fly    96 AEIGTKVVGSDNNENKTVDYLMGLVNEIQENCLDD---YFDI-----EVD--LQEVSGSY----- 145
            .|   |::..:.|:....|.|:.|:: |....:||   :|||     ::|  ||.:..:|     
Yeast   609 VE---KILEDEQNQQSVKDLLVYLLH-ISMELIDDPLLHFDIISYVEDIDERLQRLEQAYPEKLN 669

  Fly   146 --------IHWTMV-----NMYQGVQNIV 161
                    :.|..:     :..||.:|||
Yeast   670 FTSIIKGLLFWKKIGSEWASWTQGWENIV 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:349872 22/110 (20%)
TRE2NP_014899.1 PA 249..392 CDD:238300
M28_PMSA_TfR_like 417..643 CDD:349871 19/102 (19%)
TFR_dimer 668..799 CDD:461238 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.