DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and Naaladl1

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_113947.1 Gene:Naaladl1 / 83568 RGDID:620987 Length:745 Species:Rattus norvegicus


Alignment Length:300 Identity:65/300 - (21%)
Similarity:110/300 - (36%) Gaps:73/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YLLVNSHFDS---KPTSPSAGDAGQMVVAILEVLRVMCS-TKQAI---RHPVVFLLNGAEENPLQ 231
            |::..:|.||   ....||:|.|     .:||:.||:.: .|:..   |..::|...||||..|.
  Rat   367 YVIYGNHRDSWVHGAVDPSSGTA-----VLLEISRVLGTLLKKGTWRPRRSIIFASWGAEEFGLI 426

  Fly   232 ASHGFITQ--HKWAKNCKVVLNLD----------AAGNGG-SDIVFQ-----TGPNSPWL----- 273
            .|..|..:  .|..:.....:|:|          |.|... ..::|.     :.|.|..|     
  Rat   427 GSTEFTEEFLSKLQERTVTYINVDISVFSNATLRAQGTPPVQSVIFSATKEISAPGSSGLSIYDN 491

  Fly   274 -VEKYKENAPHY-LATTMAEEIFQTGILPSDTDFAIFVKYGNLIGLDMAKFINGF--------AY 328
             :.....::|.| |..:|       |.|.:.:|:|.|:.:..:..:|:|...:..        .|
  Rat   492 WIRYTNRSSPVYGLVPSM-------GTLGAGSDYASFIHFLGITSMDLAYTYDRSKTSARIYPTY 549

  Fly   329 HTKYDQFSNIPR----------GSIQNTGDNLLGLVRSIANSTELDNTEAYATGHAIFFDV---- 379
            ||.:|.|..:.:          ...:..|..||.|..|:....   |...|:.....|...    
  Rat   550 HTAFDTFDYVEKFLDPGFSSHQAVARTAGSVLLRLSDSLFLPL---NVSDYSETLQSFLQAAQEN 611

  Fly   380 LGLYFISYTESNGVIL----NYSVAGVALVLIFLSIWRTS 415
            ||....|:..|.|.::    .:..|..||....|::.::|
  Rat   612 LGALLESHNISLGPLVTAVEKFKAAAAALNQHILTLQKSS 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 57/266 (21%)
NrfD 398..638 CDD:304401 4/17 (24%)
Naaladl1NP_113947.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 119..331 CDD:239036
M28_PSMA_like <353..592 CDD:349942 52/236 (22%)
TFR_dimer 621..740 CDD:367885 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.