DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and AT4G07670

DIOPT Version :10

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_192510.1 Gene:AT4G07670 / 826236 AraportID:AT4G07670 Length:280 Species:Arabidopsis thaliana


Alignment Length:156 Identity:34/156 - (21%)
Similarity:58/156 - (37%) Gaps:50/156 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DIEVDLQEVSG-----------SYIHWTMVNMYQGVQNIVIKLSPKNTTSTTYLLVNSHFDS--- 183
            |.||.|:.:.|           |||       ...:||::..:..:.... .|:::.:|.|:   
plant   136 DAEVILKTIVGDVGPGPGILNLSYI-------VTKIQNVIGVIEGEEEPD-RYVILRNHRDTWTF 192

  Fly   184 KPTSPSAGDAGQMVVAILEVLRVMCSTKQAIRHPVVFLLNGAEENPLQASHGFITQHKWAKNCKV 248
            :...|::|.|         ||  |.::|..::|....|      :.||       :..|.....:
plant   193 RAVDPNSGTA---------VL--MEASKSYLQHIAQRL------DKLQ-------KRGWKPRRTI 233

  Fly   249 VL-NLDAAGNGGSDIVFQTGPNSPWL 273
            :| |.||...|   :|......|.||
plant   234 ILCNWDAEEYG---LVSSLSEISYWL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:349872 34/156 (22%)
AT4G07670NP_192510.1 PA <10..150 CDD:333703 5/13 (38%)
Zinc_peptidase_like <163..>248 CDD:472712 23/112 (21%)

Return to query results.
Submit another query.