DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and Tfrc

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_073203.1 Gene:Tfrc / 64678 RGDID:70488 Length:761 Species:Rattus norvegicus


Alignment Length:183 Identity:41/183 - (22%)
Similarity:63/183 - (34%) Gaps:55/183 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CKNKISDEPIEDAVRSASSK---KIKNQEQYLRGPWYLATGFLLFWALLFSAVVLPLFYRIPTGL 73
            ||..   |..|:.||.|.::   |.:|.|..     |:.....||||.|.:.:...|     ..:
  Rat    89 CKRV---EQKEECVRLAEAEEADKSENDETE-----YVPKSSRLFWADLKTLLSEKL-----NSI 140

  Fly    74 TIEDASKGVFIAERAQSNLYKLAEIGTKVVGSDNNENKTVDYLMGLVNEIQENCLDDYFDIEVDL 138
            ...|      |.::...|.|...|     .||..:||  :.|.:       ||...|:...:|..
  Rat   141 EFTD------IIKQLSQNTYTPRE-----AGSQKDEN--LAYYI-------ENLFHDFKFSKVWR 185

  Fly   139 QEVSGSYIHWTMVNMYQGVQNIVIKLSPKNTTSTTYLLVNSHFDSKPTSPSAG 191
            .|      |:             :|:..||:.|...:.:||..:..|.....|
  Rat   186 DE------HY-------------VKIQVKNSVSQNLVTINSGSNIDPVEAPEG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 23/112 (21%)
NrfD 398..638 CDD:304401
TfrcNP_073203.1 Mediates interaction with SH3BP4. /evidence=ECO:0000250|UniProtKB:P02786 1..67
Endocytosis signal. /evidence=ECO:0000250|UniProtKB:P02786 20..23
Stop-transfer sequence. /evidence=ECO:0000250|UniProtKB:P02786 58..61
PA_TfR 201..378 CDD:239043 4/19 (21%)
M28_TfR 386..611 CDD:349946
Ligand-binding. /evidence=ECO:0000250 570..761
TFR_dimer 638..751 CDD:398094
Cell attachment site, required for binding to transferrin. /evidence=ECO:0000250|UniProtKB:P02786 647..649
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.