DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and Cpq

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_113828.1 Gene:Cpq / 58952 RGDID:628610 Length:472 Species:Rattus norvegicus


Alignment Length:198 Identity:44/198 - (22%)
Similarity:74/198 - (37%) Gaps:59/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIPTG-LTIEDASKGVFIAERAQSNLYKLAEIGTKVVGSDNNENKTVDYLMG--------LVN-- 121
            :|||. :|||||.....:|.|....:..| ::|.|.. .|.:...||..:.|        ||:  
  Rat   228 KIPTACITIEDAEMMSRMASRGDKIVIHL-KMGAKTY-PDTDSFNTVAEITGSKYPEEVVLVSGH 290

  Fly   122 ----EIQENCLDDYFDIEVDLQEVSGSYIHWTMVNMYQGVQNIVIKLSPKNT------------- 169
                ::.:..|||          ..|::|.|..:::.:.     :.|.||.|             
  Rat   291 LDSWDVGQGALDD----------GGGAFISWEALSLVKD-----LGLRPKRTLRLVLWTAEEQGG 340

  Fly   170 --TSTTYLLVNSHFDSKPTSPSAGDAGQMVVAILE---------VLRVMCSTKQAIRHPVVFLLN 223
              .|..|.|..::. ||.:.....|:|..:...|:         :::.:.|..|.:....||  |
  Rat   341 VGASQYYELHKANI-SKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMSLLQPLNITKVF--N 402

  Fly   224 GAE 226
            .||
  Rat   403 DAE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 36/185 (19%)
NrfD 398..638 CDD:304401
CpqNP_113828.1 M28_Pgcp_like 47..449 CDD:193504 44/198 (22%)
PA_M28_2 130..256 CDD:240119 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.