DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and Naaladl1

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_001009546.1 Gene:Naaladl1 / 381204 MGIID:2685810 Length:745 Species:Mus musculus


Alignment Length:204 Identity:48/204 - (23%)
Similarity:82/204 - (40%) Gaps:46/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YLLVNSHFDS---KPTSPSAGDAGQMVVAILEVLRVMCS-TKQAI---RHPVVFLLNGAEENPLQ 231
            |::..:|.||   ....||:|.|     .:||:.||:.: .|:..   |..::|...||||..|.
Mouse   367 YVIYGNHRDSWVHGAVDPSSGTA-----VLLEISRVLGTLLKKGTWRPRRSIIFASWGAEEFGLI 426

  Fly   232 ASHGFITQ--HKWAKNCKVVLNLDAAGNGGSDIVFQ-TGPNSPWLVEKYKE-NAP---------- 282
            .|..|..:  .|..:.....:|:|.:....:.:..| |.|....:....|| :||          
Mouse   427 GSTEFTEEFLSKLQERTVAYINVDISVFSNATLRAQGTPPVQSVIFSATKEISAPGSSGLSIYDN 491

  Fly   283 --HYLATTMAEEIFQTGILPS------DTDFAIFVKYGNLIGLDMAKFINGF--------AYHTK 331
              .|  |.....::  |::||      .:|:|.||.:..:..:|:|...:..        .|||.
Mouse   492 WIRY--TNRTSPVY--GLVPSLGTLGAGSDYAAFVHFLGITSMDLAYTYDRSKTSARIYPTYHTA 552

  Fly   332 YDQFSNIPR 340
            :|.|..:.:
Mouse   553 FDTFDYVEK 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 48/204 (24%)
NrfD 398..638 CDD:304401
Naaladl1NP_001009546.1 Zinc_peptidase_like 53..>126 CDD:387401
PA_GCPII_like 114..344 CDD:239036
M28_PSMA_like <350..592 CDD:349942 48/204 (24%)
TFR_dimer <642..739 CDD:367885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.