DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and Naalad2

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_001100272.1 Gene:Naalad2 / 300384 RGDID:1305872 Length:778 Species:Rattus norvegicus


Alignment Length:313 Identity:65/313 - (20%)
Similarity:107/313 - (34%) Gaps:102/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 IHWTMVNMYQGVQNIVIKLSPKNTTSTTYLLVNSHFDS---KPTSPSAGDAGQMVVAILEVLRVM 207
            :|...:|....:.|::..:. .:|....|:::..|.||   ....|:.|.|     .:.|:.|  
  Rat   372 MHVHNINKITRIYNVIGTIR-GSTEPDRYVILGGHRDSWVFGGIDPTTGTA-----VLQEIAR-- 428

  Fly   208 CSTKQAI------RHPVVFLLNGAEENPLQASHGFITQHKWA-KNCKVV-------LNLDAAGNG 258
             |..:.:      |..::|....|||      .|.:...:|| :|.|::       :|.|:|..|
  Rat   429 -SFGKLVNGGWKPRRTIIFASWDAEE------FGLLGSTEWAEENAKILQERSIAYINSDSAIEG 486

  Fly   259 G-----------SDIVFQT---------GPNSPWLVEKYKENAPHYLATTMAEEIFQTGILPSDT 303
            .           ..:|::.         |..|..|.|.:.|..|    :...:|..:...|.|.:
  Rat   487 NYTLRVDCTPLLHQLVYKVAREISSPDDGFESKSLYESWLEKDP----SPENKERPRINKLGSGS 547

  Fly   304 DF-AIFVKYGNLIG-------LDMAKFINGFAYHTKYDQFSNIPRGSIQNTGD----------NL 350
            || |.|.:.|...|       ....|:.:...|||.|:.|.     .:||..|          .|
  Rat   548 DFEAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFE-----LVQNFYDPTFKKQLSVAQL 607

  Fly   351 LG-LVRSIANSTELD-NTEAYATG---------------------HAIFFDVL 380
            .| ||..:|:...:. |.:.||..                     |.:.||.|
  Rat   608 RGALVYELADCVVIPFNIQDYAKALKNYAASIFNLSKKHDQQLRDHGVSFDPL 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 65/313 (21%)
NrfD 398..638 CDD:304401
Naalad2NP_001100272.1 Zinc_peptidase_like 86..>143 CDD:417508
PA_GCPII_like 148..374 CDD:239036 0/1 (0%)
M28_PSMA_like <382..623 CDD:349942 56/264 (21%)
TFR_dimer 655..774 CDD:398094 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.