DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and NAALADL2

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:XP_011510914.1 Gene:NAALADL2 / 254827 HGNCID:23219 Length:805 Species:Homo sapiens


Alignment Length:341 Identity:65/341 - (19%)
Similarity:121/341 - (35%) Gaps:76/341 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RAQSNLYKL------AEIGTKVVGSD--NNENKTVDYLMGLVNEIQENCLDDYFDIEVDLQEVSG 143
            :::|||..|      |.:..|::.|.  ..:|:....|....|||:.        :.:.:|.|  
Human   379 QSRSNLTSLLVQPISAPLVAKLISSPKARTKNEACSSLELPNNEIRV--------VSMQVQTV-- 433

  Fly   144 SYIHWTMVNMYQGVQNIVIKLSPKNTTSTTYLLVNSHFDSKPTSPSAGDAGQMVVAILEVLRVMC 208
                 |.:.....|...|:.|    |:...|::|.||..:..:......|....:....:..:|.
Human   434 -----TKLKTVTNVVGFVMGL----TSPDRYIIVGSHHHTAHSYNGQEWASSTAIITAFIRALMS 489

  Fly   209 STKQAIR--HPVVFLLNGAEENPLQASHGFITQHKWAKNCKVVL--------NLDAAGNGGSDIV 263
            ..|:..|  ..:||...|.      .:.|.|..::|.::.|.||        :|.:...|.|.:.
Human   490 KVKRGWRPDRTIVFCSWGG------TAFGNIGSYEWGEDFKKVLQKNVVAYISLHSPIRGNSSLY 548

  Fly   264 FQTGPNSPWL-VEKYKENAPHYLATTMAEEIFQTGI----LPSDTDFAIFVKYGNLIGLDMAKFI 323
            ....|:...| |||...|.      |...:..:|.|    :..|.|:.|     |.:|:.:.:| 
Human   549 PVASPSLQQLVVEKNNFNC------TRRAQCPETNISSIQIQGDADYFI-----NHLGVPIVQF- 601

  Fly   324 NGFAYHTKYDQFSNIPRGSIQNTGDNLLGLVRSIANSTELDNTEAYATGHAIFFDVLGLYFISYT 388
                   .|:....:       .|.:.|...|....:|:::..:.....|.....:.|...:.. 
Human   602 -------AYEDIKTL-------EGPSFLSEARFSTRATKIEEMDPSFNLHETITKLSGEVILQI- 651

  Fly   389 ESNGVILNYSVAGVAL 404
             :|..:|.::...:||
Human   652 -ANEPVLPFNALDIAL 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 61/322 (19%)
NrfD 398..638 CDD:304401 2/7 (29%)
NAALADL2XP_011510914.1 Peptidases_S8_S53 268..420 CDD:299169 9/40 (23%)
Zinc_peptidase_like 437..659 CDD:301362 48/259 (19%)
TFR_dimer 686..>744 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.