DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and FOLH1

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:XP_016872921.1 Gene:FOLH1 / 2346 HGNCID:3788 Length:805 Species:Homo sapiens


Alignment Length:351 Identity:60/351 - (17%)
Similarity:116/351 - (33%) Gaps:120/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 YFDIEVDLQEVSGS--------------------------------YIHWT--MVNMYQGVQNIV 161
            |:|.:..|:::.||                                :||.|  :..:|..:..:.
Human   354 YYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLR 418

  Fly   162 IKLSPKNTTSTTYLLVNSHFDS---KPTSPSAGDAGQMVVAILEVLRVMCSTKQ---AIRHPVVF 220
            ..:.|..     |:::..|.||   ....|.:|.|     .:.|::|...:.|:   ..|..::|
Human   419 GAVEPDR-----YVILGGHRDSWVFGGIDPQSGAA-----VVHEIVRSFGTLKKEGWRPRRTILF 473

  Fly   221 LLNGAEENPLQASHGFITQHKWA-KNCKVV-------LNLDAAGNGGSDIVFQTGPNSPWLVEKY 277
            ....|||      .|.:...:|| :|.:::       :|.|::..|...:.....|....||   
Human   474 ASWDAEE------FGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLV--- 529

  Fly   278 KENAPHYLATTMAEEIFQTGILPSDTDFAIFVKYGNLIGLDMAKFINGFAYHTKYDQFSNIPRGS 342
                 |.|...:..        |.:             |.:.......:...:...:||.:||.|
Human   530 -----HNLTKELKS--------PDE-------------GFEGKSLYESWTKKSPSPEFSGMPRIS 568

  Fly   343 IQNTGDNL------LGLVRSIANST---ELDNTEAYATGHAI---------FFDVLGLYFISYTE 389
            ...:|::.      ||:....|..|   |.:....|...|::         |:|.:..|.::..:
Human   569 KLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQ 633

  Fly   390 ---------SNGVILNYSVAGVALVL 406
                     :|.::|.:.....|:||
Human   634 VRGGMVFELANSIVLPFDCRDYAVVL 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 55/321 (17%)
NrfD 398..638 CDD:304401 3/9 (33%)
FOLH1XP_016872921.1 Zinc_peptidase_like 113..>169 CDD:301362
PA_GCPII_like 175..401 CDD:239036 5/46 (11%)
M28_PSMA_like 403..650 CDD:193568 50/291 (17%)
TFR_dimer 687..802 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.