DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and NAALAD2

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:XP_016872532.1 Gene:NAALAD2 / 10003 HGNCID:14526 Length:775 Species:Homo sapiens


Alignment Length:391 Identity:78/391 - (19%)
Similarity:140/391 - (35%) Gaps:101/391 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 IHWTMVNMYQGVQNIVIKLSPKNTTSTTYLLVNSHFDS---KPTSPSAGDAGQMVVAIL-EVLR- 205
            :|...:|....:.|:|..:. .:.....|:::..|.||   ....|::|      ||:| |:.| 
Human   369 MHVYNINKITRIYNVVGTIR-GSVEPDRYVILGGHRDSWVFGAIDPTSG------VAVLQEIARS 426

  Fly   206 --VMCSTKQAIRHPVVFLLNGAEENPLQASHGFITQHKWA-KNCKVV-------LNLDAAGNGG- 259
              .:.|.....|..::|....|||      .|.:...:|| :|.|::       :|.|::..|. 
Human   427 FGKLMSKGWRPRRTIIFASWDAEE------FGLLGSTEWAEENVKILQERSIAYINSDSSIEGNY 485

  Fly   260 ------SDIVFQ-------------TGPNSPWLVEKYKENAPHYLATTMAEEIFQTGILPSDTDF 305
                  :.:::|             .|..|..|.|.:.|..|    :...:.:.:...|.|.:||
Human   486 TLRVDCTPLLYQLVYKLTKEIPSPDDGFESKSLYESWLEKDP----SPENKNLPRINKLGSGSDF 546

  Fly   306 -AIFVKYGNLIG-------LDMAKFINGFAYHTKYDQFSNIP----------------RG----- 341
             |.|.:.|...|       ....|:.:...|||.|:.|..:.                ||     
Human   547 EAYFQRLGIASGRARYTKNKKTDKYSSYPVYHTIYETFELVEKFYDPTFKKQLSVAQLRGALVYE 611

  Fly   342 ---------SIQNTGDNLLGLVRSIANSTELDNTEAYATGHAIFFDVLGLYFISYTESNG----- 392
                     :||:..:.|.....||.|.::..:.:  .|.|.:.||.|.....:::|:..     
Human   612 LVDSKIIPFNIQDYAEALKNYAASIYNLSKKHDQQ--LTDHGVSFDSLFSAVKNFSEAASDFHKR 674

  Fly   393 ---VILNYSVAGVALVLIFLSIWRTSSISRVSIGHVLCWFILIFVLQIIAFVLGLGLPIVVAYVF 454
               |.||..:| |.::...|.:...:.|..:.:...|.:..:||.........|...|.:...:|
Human   675 LIQVDLNNPIA-VRMMNDQLMLLERAFIDPLGLPGKLFYRHIIFAPSSHNKYAGESFPGIYDAIF 738

  Fly   455 D 455
            |
Human   739 D 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 63/313 (20%)
NrfD 398..638 CDD:304401 11/58 (19%)
NAALAD2XP_016872532.1 Zinc_peptidase_like 93..>139 CDD:301362
PA_GCPII_like 145..371 CDD:239036 0/1 (0%)
M28_PSMA_like 373..620 CDD:193568 51/263 (19%)
TFR_dimer 657..772 CDD:282153 16/84 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.