DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10073 and naaladl1

DIOPT Version :9

Sequence 1:NP_001261090.1 Gene:CG10073 / 37225 FlyBaseID:FBgn0034440 Length:881 Species:Drosophila melanogaster
Sequence 2:NP_001091660.1 Gene:naaladl1 / 100000223 ZFINID:ZDB-GENE-060526-100 Length:740 Species:Danio rerio


Alignment Length:358 Identity:78/358 - (21%)
Similarity:131/358 - (36%) Gaps:114/358 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EDASKGVFIAERAQSNLYKLAEIGTKVVGSDNNENKTVDYLMGLVNEIQENCLDDYFDIEVDLQE 140
            |||..|   .:.|....|||...|.|...|..  |.||.             ||.|     ::::
Zfish   304 EDAPAG---WQGAFDCTYKLGGPGFKATSSFT--NSTVH-------------LDTY-----NIEK 345

  Fly   141 VSGSYIHWTMVNMYQGVQNIVIKLSPKNTTSTTYLLVNSHFDS---KPTSPSAGDAGQMVVAILE 202
            :..|.   .::.:.:|      .:.|..     |::..:|.||   ....||:|.|     .:||
Zfish   346 IENSA---NVMGVIRG------SVEPDR-----YVIYGNHRDSWVHGAIDPSSGTA-----VMLE 391

  Fly   203 VLRVMCST----KQAIRHPVVFLLNGAEENPLQASHGFITQH--KWAKNCKVVLNLD-------- 253
            :.||:...    |...|..::|...||||..|..|..:..::  |.::.....:|:|        
Zfish   392 ITRVLGKMVKEGKWRPRRSIIFGSWGAEEFGLIGSAEYTEEYFSKLSERTVAYINVDISVFANAT 456

  Fly   254 ---AAGNGGSDIVFQTGP--NSP---------WLVEKYKENAPHYLATTMAEEIFQTGILP---- 300
               :|......::|....  ::|         | :..|...:|:|            ||:|    
Zfish   457 LRASASPAAQSVLFTASKQVDAPGTTMSVYDNW-IRYYNRTSPNY------------GIIPNVGF 508

  Fly   301 ---SDTDFAIFVKYGNLIGLDMAKFINGF--------AYHTKYDQF----SNIPRG-----SIQN 345
               :.:|:|.|:.|..:..:|::.:.:..        ||||.||.|    :.|..|     ::..
Zfish   509 LTGAGSDYAAFIHYLGITSMDISYYYDQSKTRARIYPAYHTAYDTFDYASTYIDPGFTSHQAVAR 573

  Fly   346 TGDNLLGLVRSIANSTELD-NTEAYATGHAIFF 377
            |..|:|   ..:|:|..|. |...||.....:|
Zfish   574 TAGNVL---LRLADSLLLPFNCSDYAESLEQYF 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10073NP_001261090.1 M28_Fxna_like 80..387 CDD:193497 75/354 (21%)
NrfD 398..638 CDD:304401
naaladl1NP_001091660.1 Zinc_peptidase_like 50..>124 CDD:301362
PA_GCPII_like 113..338 CDD:239036 14/51 (27%)
M28_PSMA_like 335..578 CDD:193568 57/292 (20%)
TFR_dimer 624..736 CDD:282153
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.